Lineage for d1sip__ (1sip -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) 
Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species) Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (10 PDB entries) 
Domain d1sip__: 1sip - [26757]
Details for d1sip__
PDB Entry: 1sip (more details), 2.3 Å
PDB Description: alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase
SCOP Domain Sequences for d1sip__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sip__ b.50.1.1 (-) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nveievlgkrirgtimtgdtpinifgrnlltalgmslnf
SCOP Domain Coordinates for d1sip__:
Click to download the PDB-style file with coordinates for d1sip__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sip__:
- d1sip__ first appeared (with stable ids) in SCOP 1.55
- d1sip__ appears in SCOP 1.59
- d1sip__ appears in the current release, SCOPe 2.08, called d1sipa_
View in 3D