![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) |
![]() | Domain d4w81a_: 4w81 A: [267568] automated match to d4jvpa_ complexed with so4 |
PDB Entry: 4w81 (more details), 2.25 Å
SCOPe Domain Sequences for d4w81a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w81a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]} maevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapgta yyafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsvdy wgqgtqvtvss
Timeline for d4w81a_: