Class b: All beta proteins [48724] (119 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species) |
Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries) |
Domain d1ytja_: 1ytj A: [26756] complexed with ppn; mutant |
PDB Entry: 1ytj (more details), 2.5 Å
SCOP Domain Sequences for d1ytja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytja_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains} pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf
Timeline for d1ytja_: