Lineage for d1ytja_ (1ytj A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168884Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 168885Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 168886Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 169230Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 169231Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)
  8. 169249Domain d1ytja_: 1ytj A: [26756]

Details for d1ytja_

PDB Entry: 1ytj (more details), 2.5 Å

PDB Description: siv protease crystallized with peptide product

SCOP Domain Sequences for d1ytja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytja_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf

SCOP Domain Coordinates for d1ytja_:

Click to download the PDB-style file with coordinates for d1ytja_.
(The format of our PDB-style files is described here.)

Timeline for d1ytja_: