Lineage for d1ytja_ (1ytj A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (7 PDB entries)
  8. Domain d1ytja_: 1ytj A: [26756]
    protein/DNA complex; protein/RNA complex

Details for d1ytja_

PDB Entry: 1ytj (more details), 2.5 Å

PDB Description: siv protease crystallized with peptide product
PDB Compounds: (A:) siv protease

SCOPe Domain Sequences for d1ytja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytja_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf

SCOPe Domain Coordinates for d1ytja_ are not available.

Timeline for d1ytja_: