SCOPe 2.07: Domain d4v1an_: 4v1a n:

Lineage for d4v1an_ (4v1a n:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [267696] (2 PDB entries)

8. Domain d4v1an_: 4v1a n: [267558]
   complexed with zn

Details for d4v1an_

PDB Entry: 4v1a, 3.4 Å

PDB Description: structure of the large subunit of the mammalian mitoribosome, part 2 of 2

PDB Compounds: (n:) mitoribosomal protein ml51, mrpl51

SCOPe Domain Sequences for d4v1an_:

Sequence; same for both SEQRES and ATOM records:

>d4v1an_ i.1.1.2 (n:) Eukaryotic, mitochondrial (54S or 39S subunit) {Pig (Sus scrofa) [TaxId: 9823]}
fhvrvtlpprkvvdrwnekramfgvydnigilgnfekhpkelikgpiwlrgwkgnelqrc
irkkrmvgnrmfiddlhnlnkrisylykhfnrhgkyr

Timeline for d4v1an_:

• d4v1an_ first appeared in SCOPe 2.05
  
• d4v1an_ appears in SCOPe 2.06
  
• d4v1an_ appears in the current release, SCOPe 2.08