| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [267696] (2 PDB entries) |
| Domain d4v1am_: 4v1a m: [267557] complexed with zn |
PDB Entry: 4v1a (more details), 3.4 Å
SCOPe Domain Sequences for d4v1am_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v1am_ i.1.1.2 (m:) Eukaryotic, mitochondrial (54S or 39S subunit) {Pig (Sus scrofa) [TaxId: 9823]}
lvcppiqsrtyippedlqsrleshvkevfgssvpsnwqdisledvhlkfsflarlandlr
havpnsrlhqmcrvrdvldfynvpvqdrskfdeliasnlphnlkitwgy
Timeline for d4v1am_: