Lineage for d2sam__ (2sam -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231370Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 231371Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 231372Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 231741Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 231742Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)
  8. 231759Domain d2sam__: 2sam - [26755]
    complexed with epn; mutant

Details for d2sam__

PDB Entry: 2sam (more details), 2.4 Å

PDB Description: structure of the protease from simian immunodeficiency virus: complex with an irreversible non-peptide inhibitor

SCOP Domain Sequences for d2sam__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sam__ b.50.1.1 (-) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nveievlgkrikgtimtgdtpinifgrnlltalgmslnf

SCOP Domain Coordinates for d2sam__:

Click to download the PDB-style file with coordinates for d2sam__.
(The format of our PDB-style files is described here.)

Timeline for d2sam__: