SCOP 1.61: Domain d2sam__: 2sam -

Lineage for d2sam__ (2sam -)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)

8. Domain d2sam__: 2sam - [26755]

Details for d2sam__

PDB Entry: 2sam, 2.4 Å

PDB Description: structure of the protease from simian immunodeficiency virus: complex with an irreversible non-peptide inhibitor

SCOP Domain Sequences for d2sam__:

Sequence; same for both SEQRES and ATOM records:

>d2sam__ b.50.1.1 (-) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nveievlgkrikgtimtgdtpinifgrnlltalgmslnf

Timeline for d2sam__:

• d2sam__ first appeared (with stable ids) in SCOP 1.55
  
• d2sam__ appears in SCOP 1.59
  
• d2sam__ appears in SCOP 1.63
  
• d2sam__ appears in the current release, SCOPe 2.08, called d2sama_