Lineage for d4v195_ (4v19 5:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648196Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species)
  7. 2648234Species Pig (Sus scrofa) [TaxId:9823] [267696] (2 PDB entries)
  8. 2648263Domain d4v195_: 4v19 5: [267522]
    complexed with mg, zn

Details for d4v195_

PDB Entry: 4v19 (more details), 3.4 Å

PDB Description: structure of the large subunit of the mammalian mitoribosome, part 1 of 2
PDB Compounds: (5:) mitoribosomal protein bl32m, mrpl32

SCOPe Domain Sequences for d4v195_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v195_ i.1.1.2 (5:) Eukaryotic, mitochondrial (54S or 39S subunit) {Pig (Sus scrofa) [TaxId: 9823]}
aapknrrsievnrcrrrnpqklikvknnidvcpecghlkqkhilcgycyekvrketaeir
rqmgkqeggpfrapttetvvlysgetpseqdqgkriiererkrpswftqn

SCOPe Domain Coordinates for d4v195_:

Click to download the PDB-style file with coordinates for d4v195_.
(The format of our PDB-style files is described here.)

Timeline for d4v195_: