Lineage for d4v0la1 (4v0l A:16-180)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (116 species)
    not a true protein
  7. 2114172Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255698] (6 PDB entries)
  8. 2114175Domain d4v0la1: 4v0l A:16-180 [267515]
    Other proteins in same PDB: d4v0la2, d4v0lb2
    automated match to d2gaoa1
    complexed with gtp, mg

Details for d4v0la1

PDB Entry: 4v0l (more details), 2.2 Å

PDB Description: Crystal structure of the CrARL6DN in the GTP bound form
PDB Compounds: (A:) arf-like small gtpase

SCOPe Domain Sequences for d4v0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v0la1 c.37.1.0 (A:16-180) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgagr
yrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpva
mppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls

SCOPe Domain Coordinates for d4v0la1:

Click to download the PDB-style file with coordinates for d4v0la1.
(The format of our PDB-style files is described here.)

Timeline for d4v0la1:

  • d4v0la1 first appeared in SCOPe 2.05, called d4v0la_

View in 3D
Domains from same chain:
(mouse over for more information)
d4v0la2