SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4v0la1 (4v0l A:16-180)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (121 species)
    not a true protein
  7. 2114172Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255698] (6 PDB entries)
  8. 2114175Domain d4v0la1: 4v0l A:16-180 [267515]
    Other proteins in same PDB: d4v0la2, d4v0lb2
    automated match to d2gaoa1
    complexed with gtp, mg

Details for d4v0la1

PDB Entry: 4v0l (more details), 2.2 Å

PDB Description: Crystal structure of the CrARL6DN in the GTP bound form
PDB Compounds: (A:) arf-like small gtpase

SCOPe Domain Sequences for d4v0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v0la1 c.37.1.0 (A:16-180) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgagr
yrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpva
mppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls

SCOPe Domain Coordinates for d4v0la1:

Click to download the PDB-style file with coordinates for d4v0la1.
(The format of our PDB-style files is described here.)

Timeline for d4v0la1:

  • d4v0la1 first appeared in SCOPe 2.05, called d4v0la_

View in 3D
Domains from same chain:
(mouse over for more information)
d4v0la2