| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein automated matches [190029] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries) |
| Domain d4uw5f_: 4uw5 F: [267513] automated match to d3zxfb_ complexed with 4s0 |
PDB Entry: 4uw5 (more details), 2.04 Å
SCOPe Domain Sequences for d4uw5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uw5f_ b.29.1.3 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif
Timeline for d4uw5f_: