Lineage for d4uw5d_ (4uw5 D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050578Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2050771Protein automated matches [190029] (5 species)
    not a true protein
  7. 2050779Species Human (Homo sapiens) [TaxId:9606] [186749] (9 PDB entries)
  8. 2050795Domain d4uw5d_: 4uw5 D: [267511]
    automated match to d3zxfb_
    complexed with 4s0

Details for d4uw5d_

PDB Entry: 4uw5 (more details), 2.04 Å

PDB Description: Human galectin-7 in complex with a galactose based dendron D2-2.
PDB Compounds: (D:) human galectin-7

SCOPe Domain Sequences for d4uw5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uw5d_ b.29.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif

SCOPe Domain Coordinates for d4uw5d_:

Click to download the PDB-style file with coordinates for d4uw5d_.
(The format of our PDB-style files is described here.)

Timeline for d4uw5d_: