Lineage for d1ytgb_ (1ytg B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) 
Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species) Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (10 PDB entries) 
Domain d1ytgb_: 1ytg B: [26751]
Details for d1ytgb_
PDB Entry: 1ytg (more details), 2.3 Å
PDB Description: siv protease crystallized with peptide product
SCOP Domain Sequences for d1ytgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytgb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
SCOP Domain Coordinates for d1ytgb_:
Click to download the PDB-style file with coordinates for d1ytgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ytgb_:
- d1ytgb_ appears in SCOP 1.57
- d1ytgb_ appears in the current release, SCOPe 2.08
View in 3D
