![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
![]() | Protein automated matches [190029] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries) |
![]() | Domain d4uw5a_: 4uw5 A: [267508] automated match to d3zxfb_ complexed with 4s0 |
PDB Entry: 4uw5 (more details), 2.04 Å
SCOPe Domain Sequences for d4uw5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uw5a_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev ggdvqldsvrif
Timeline for d4uw5a_: