SCOPe 2.08: Domain d4uw4b_: 4uw4 B:

Lineage for d4uw4b_ (4uw4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)

8. Domain d4uw4b_: 4uw4 B: [267507]
   automated match to d3zxfb_
   complexed with 4s0

Details for d4uw4b_

PDB Entry: 4uw4, 1.77 Å

PDB Description: human galectin-7 in complex with a galactose based dendron d2-1.

PDB Compounds: (B:) galectin-7

SCOPe Domain Sequences for d4uw4b_:

Sequence; same for both SEQRES and ATOM records:

>d4uw4b_ b.29.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfn
skeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlve
vggdvqldsvrif

Timeline for d4uw4b_:

• d4uw4b_ first appeared in SCOPe 2.05
  
• d4uw4b_ appears in SCOPe 2.07