SCOPe 2.05: Domain d4uvcb1: 4uvc B:308-375

Lineage for d4uvcb1 (4uvc B:308-375)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family)
   Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1

5. Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)

6. Protein Demethylase interaction domain of CoREST [267660] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [267739] (21 PDB entries)

8. Domain d4uvcb1: 4uvc B:308-375 [267502]
   Other proteins in same PDB: d4uvca1, d4uvca2, d4uvca3, d4uvcb2
   complexed with d52

Details for d4uvcb1

PDB Entry: 4uvc, 3.1 Å

PDB Description: LSD1(KDM1A)-CoREST in complex with 1-Phenyl-Tranylcypromine

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d4uvcb1:

Sequence; same for both SEQRES and ATOM records:

>d4uvcb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

Timeline for d4uvcb1:

• d4uvcb1 is new in SCOPe 2.05-stable
  
• d4uvcb1 appears in SCOPe 2.06
  
• d4uvcb1 appears in the current release, SCOPe 2.08