| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family) ![]() Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1 |
| Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein) |
| Protein Demethylase interaction domain of CoREST [267660] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [267739] (22 PDB entries) |
| Domain d4uvcb1: 4uvc B:308-375 [267502] Other proteins in same PDB: d4uvca1, d4uvca2, d4uvca3, d4uvcb2 complexed with d52 |
PDB Entry: 4uvc (more details), 3.1 Å
SCOPe Domain Sequences for d4uvcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uvcb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev
Timeline for d4uvcb1: