Lineage for d4uvcb1 (4uvc B:308-375)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040700Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family) (S)
    Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1
  5. 3040701Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)
  6. 3040702Protein Demethylase interaction domain of CoREST [267660] (1 species)
  7. 3040703Species Human (Homo sapiens) [TaxId:9606] [267739] (22 PDB entries)
  8. 3040723Domain d4uvcb1: 4uvc B:308-375 [267502]
    Other proteins in same PDB: d4uvca1, d4uvca2, d4uvca3, d4uvcb2
    complexed with d52

Details for d4uvcb1

PDB Entry: 4uvc (more details), 3.1 Å

PDB Description: LSD1(KDM1A)-CoREST in complex with 1-Phenyl-Tranylcypromine
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d4uvcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uvcb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

SCOPe Domain Coordinates for d4uvcb1:

Click to download the PDB-style file with coordinates for d4uvcb1.
(The format of our PDB-style files is described here.)

Timeline for d4uvcb1: