SCOPe 2.08: Domain d4uvca1: 4uvc A:171-273

Lineage for d4uvca1 (4uvc A:171-273)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (4 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries)
   Uniprot O60341 169-279

8. Domain d4uvca1: 4uvc A:171-273 [267499]
   Other proteins in same PDB: d4uvca2, d4uvca3, d4uvcb1, d4uvcb2
   complexed with d52

Details for d4uvca1

PDB Entry: 4uvc, 3.1 Å

PDB Description: LSD1(KDM1A)-CoREST in complex with 1-Phenyl-Tranylcypromine

PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d4uvca1:

Sequence; same for both SEQRES and ATOM records:

>d4uvca1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

Timeline for d4uvca1:

• d4uvca1 first appeared in SCOPe 2.05
  
• d4uvca1 appears in SCOPe 2.07