Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.18: SWIRM domain [140222] (4 proteins) Pfam PF04433; contains extra N-terminal helix |
Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries) Uniprot O60341 169-279 |
Domain d4uvca1: 4uvc A:171-273 [267499] Other proteins in same PDB: d4uvca2, d4uvca3, d4uvcb1, d4uvcb2 complexed with d52 |
PDB Entry: 4uvc (more details), 3.1 Å
SCOPe Domain Sequences for d4uvca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uvca1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl
Timeline for d4uvca1: