Lineage for d4uvba2 (4uvb A:274-654,A:764-836)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849464Protein Lysine-specific histone demethylase 1, LSD1 [159432] (1 species)
  7. 2849465Species Human (Homo sapiens) [TaxId:9606] [159433] (27 PDB entries)
    Uniprot O60341 274-654,764-836
  8. 2849482Domain d4uvba2: 4uvb A:274-654,A:764-836 [267495]
    Other proteins in same PDB: d4uvba1, d4uvba3, d4uvbb1, d4uvbb2
    complexed with d51

Details for d4uvba2

PDB Entry: 4uvb (more details), 2.8 Å

PDB Description: LSD1(KDM1A)-CoREST in complex with 1-Methyl-Tranylcypromine (1S,2R)
PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d4uvba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uvba2 c.3.1.2 (A:274-654,A:764-836) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
ptkktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamv
vtglggnpmavvskqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsyls
hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlke
kikelhqqykeasevkpprditaeflvkskhrdltalckeydelaetqgkleeklqelea
nppsdvylssrdrqildwhfanlefanatplstlslkhwdqdddfeftgshltvrngysc
vpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqq
ppavqfvpplpewktsavqrmXvaagssgndydlmaqpitpgpsipgapqpiprlffage
htirnypatvhgallsglreagriadqflgamytl

SCOPe Domain Coordinates for d4uvba2:

Click to download the PDB-style file with coordinates for d4uvba2.
(The format of our PDB-style files is described here.)

Timeline for d4uvba2: