Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries) Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167 |
Domain d1tcxb_: 1tcx B: [26749] protein/DNA complex; protein/RNA complex; complexed with im1; mutant |
PDB Entry: 1tcx (more details), 2.3 Å
SCOPe Domain Sequences for d1tcxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcxb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwqrplvtikiggqlkealldtgaddtileemslpgrwkpkmvggiggfikvrqyd qilieicghkaigtvlvgptpiniigrnlltqigctlnf
Timeline for d1tcxb_: