![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
![]() | Protein REST corepressor 1, CoREST [140165] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries) Uniprot Q9UKL0 376-440 |
![]() | Domain d4uv8b2: 4uv8 B:376-440 [267483] Other proteins in same PDB: d4uv8a1, d4uv8a2, d4uv8a3, d4uv8b1 complexed with d69 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4uv8 (more details), 2.8 Å
SCOPe Domain Sequences for d4uv8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uv8b2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq eweae
Timeline for d4uv8b2: