Lineage for d1tcxa_ (1tcx A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377363Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 377364Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 377365Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 377751Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 377752Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)
  8. 377762Domain d1tcxa_: 1tcx A: [26748]

Details for d1tcxa_

PDB Entry: 1tcx (more details), 2.3 Å

PDB Description: hiv triple mutant protease complexed with inhibitor sb203386

SCOP Domain Sequences for d1tcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcxa_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwqrplvtikiggqlkealldtgaddtileemslpgrwkpkmvggiggfikvrqyd
qilieicghkaigtvlvgptpiniigrnlltqigctlnf

SCOP Domain Coordinates for d1tcxa_:

Click to download the PDB-style file with coordinates for d1tcxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tcxa_: