SCOP 1.61: Domain d1tcxa_: 1tcx A:

Lineage for d1tcxa_ (1tcx A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)

8. Domain d1tcxa_: 1tcx A: [26748]

Details for d1tcxa_

PDB Entry: 1tcx, 2.3 Å

PDB Description: hiv triple mutant protease complexed with inhibitor sb203386

SCOP Domain Sequences for d1tcxa_:

Sequence; same for both SEQRES and ATOM records:

>d1tcxa_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwqrplvtikiggqlkealldtgaddtileemslpgrwkpkmvggiggfikvrqyd
qilieicghkaigtvlvgptpiniigrnlltqigctlnf

Timeline for d1tcxa_:

• d1tcxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1tcxa_ appears in SCOP 1.59
  
• d1tcxa_ appears in SCOP 1.63
  
• d1tcxa_ appears in the current release, SCOPe 2.08