Lineage for d4uqpa_ (4uqp A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019109Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)
  8. 3019112Domain d4uqpa_: 4uqp A: [267475]
    Other proteins in same PDB: d4uqpq_, d4uqpr_
    automated match to d1ubks_
    complexed with f3s, fco, gly, gol, h2s, mg, ni, sf4, sot; mutant

Details for d4uqpa_

PDB Entry: 4uqp (more details), 1.42 Å

PDB Description: high-resolution structure of the d. fructosovorans nife-hydrogenase l122a mutant after exposure to air
PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d4uqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uqpa_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d4uqpa_:

Click to download the PDB-style file with coordinates for d4uqpa_.
(The format of our PDB-style files is described here.)

Timeline for d4uqpa_: