Lineage for d4uqha1 (4uqh A:32-477)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005985Species Trypanosoma cruzi [TaxId:5693] [196511] (10 PDB entries)
  8. 2005993Domain d4uqha1: 4uqh A:32-477 [267470]
    Other proteins in same PDB: d4uqha2
    automated match to d3khma_
    complexed with 25s, hem, so4

Details for d4uqha1

PDB Entry: 4uqh (more details), 2.43 Å

PDB Description: Crystal structure of Trypanosoma cruzi CYP51 bound to the inhibitor (R)-N-(3-(1H-indol-3-yl)-1-oxo-1-(pyridin-4-ylamino)propan-2-yl)-4-(4-(3,4-difluorophenyl)piperazin-1-yl)-2-fluorobenzamide.
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4uqha1:

Sequence, based on SEQRES records: (download)

>d4uqha1 a.104.1.0 (A:32-477) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavyr
dgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqln
ydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhde
eafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrde
vpdpdyhtmvvgptlnqclvkytrkk

Sequence, based on observed residues (ATOM records): (download)

>d4uqha1 a.104.1.0 (A:32-477) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivareketsdllggllkavyrdgtrmsl
hevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvmde
mpfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpnpr
lwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpdyh
tmvvgptlnqclvkytrkk

SCOPe Domain Coordinates for d4uqha1:

Click to download the PDB-style file with coordinates for d4uqha1.
(The format of our PDB-style files is described here.)

Timeline for d4uqha1:

  • d4uqha1 first appeared in SCOPe 2.05, called d4uqha_

View in 3D
Domains from same chain:
(mouse over for more information)
d4uqha2