Lineage for d1az5__ (1az5 -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61254Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 61552Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 61553Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (10 PDB entries)
  8. 61554Domain d1az5__: 1az5 - [26747]

Details for d1az5__

PDB Entry: 1az5 (more details), 2 Å

PDB Description: unliganded siv protease structure in an "open" conformation

SCOP Domain Sequences for d1az5__:

Sequence, based on SEQRES records: (download)

>d1az5__ b.50.1.1 (-) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf

Sequence, based on observed residues (ATOM records): (download)

>d1az5__ b.50.1.1 (-) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivgfintkeyknvev
evlgkrikgtimtgdtpinifgrnlltalgmslnf

SCOP Domain Coordinates for d1az5__:

Click to download the PDB-style file with coordinates for d1az5__.
(The format of our PDB-style files is described here.)

Timeline for d1az5__: