Lineage for d4uove_ (4uov E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1805718Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1805719Protein automated matches [191011] (12 species)
    not a true protein
  7. 1805800Species Thermovibrio ammonificans [TaxId:228745] [259326] (2 PDB entries)
  8. 1805805Domain d4uove_: 4uov E: [267464]
    automated match to d4c3ta_
    complexed with azm, b3p, cl, pe3, peg, pg5, pge, so4, tla, zn

Details for d4uove_

PDB Entry: 4uov (more details), 1.85 Å

PDB Description: The structure of a tetrameric alpha-carbonic anhydrase from Thermovibrio ammonificans reveals a core formed around intermolecular disulfides, which contribute to its thermostability.
PDB Compounds: (E:) Carbonate dehydratase

SCOPe Domain Sequences for d4uove_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uove_ b.74.1.0 (E:) automated matches {Thermovibrio ammonificans [TaxId: 228745]}
gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk

SCOPe Domain Coordinates for d4uove_:

Click to download the PDB-style file with coordinates for d4uove_.
(The format of our PDB-style files is described here.)

Timeline for d4uove_: