| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
| Protein automated matches [191087] (19 species) not a true protein |
| Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [259554] (3 PDB entries) |
| Domain d4uofb_: 4uof B: [267455] automated match to d4uoha_ complexed with dat, mg |
PDB Entry: 4uof (more details), 2.1 Å
SCOPe Domain Sequences for d4uofb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uofb_ d.58.6.0 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasedllkqhyidladkpfy
pglckymssgpvvamcwegtgvvktarvmmgetrpadskpgtirgdfcievgrniihgsd
svesankeialwfkpeelvswtqtneswiye
Timeline for d4uofb_: