![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (42 species) not a true protein |
![]() | Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258563] (5 PDB entries) |
![]() | Domain d4uo8b1: 4uo8 B:1-172 [267453] Other proteins in same PDB: d4uo8a_, d4uo8b2 automated match to d4uo4b_ complexed with nag, so4 |
PDB Entry: 4uo8 (more details), 3 Å
SCOPe Domain Sequences for d4uo8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo8b1 h.3.1.0 (B:1-172) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]} gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq
Timeline for d4uo8b1: