Lineage for d4uo8a_ (4uo8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776026Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258560] (6 PDB entries)
  8. 2776035Domain d4uo8a_: 4uo8 A: [267452]
    Other proteins in same PDB: d4uo8b1, d4uo8b2
    automated match to d4unzc_
    complexed with nag, so4

Details for d4uo8a_

PDB Entry: 4uo8 (more details), 3 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin in complex with 6so4-3sln
PDB Compounds: (A:) ha1

SCOPe Domain Sequences for d4uo8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo8a_ b.19.1.2 (A:) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli
damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw
tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss
nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk
yirqntlklatgmrnvpek

SCOPe Domain Coordinates for d4uo8a_:

Click to download the PDB-style file with coordinates for d4uo8a_.
(The format of our PDB-style files is described here.)

Timeline for d4uo8a_: