Lineage for d4uo7d1 (4uo7 D:1-172)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267708Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258565] (4 PDB entries)
  8. 2267713Domain d4uo7d1: 4uo7 D:1-172 [267449]
    Other proteins in same PDB: d4uo7a_, d4uo7b2, d4uo7c_, d4uo7d2, d4uo7e_, d4uo7f2
    automated match to d4uo4b_
    complexed with nag, so4

Details for d4uo7d1

PDB Entry: 4uo7 (more details), 3 Å

PDB Description: Structure of the A_Canine_Colorado_17864_06 H3 haemagglutinin in complex with 6SO4 Sialyl Lewis X
PDB Compounds: (D:) haemagglutinin ha2

SCOPe Domain Sequences for d4uo7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo7d1 h.3.1.0 (D:1-172) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo7d1:

Click to download the PDB-style file with coordinates for d4uo7d1.
(The format of our PDB-style files is described here.)

Timeline for d4uo7d1: