SCOPe 2.06: Domain d4uo0e_: 4uo0 E:

Lineage for d4uo0e_ (4uo0 E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (25 species)
   not a true protein

7. Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258558] (2 PDB entries)

8. Domain d4uo0e_: 4uo0 E: [267442]
   Other proteins in same PDB: d4uo0b_, d4uo0d_, d4uo0f_
   automated match to d4unzc_
   complexed with bma, edo, nag

Details for d4uo0e_

PDB Entry: 4uo0, 1.9 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4uo0e_:

Sequence; same for both SEQRES and ATOM records:

>d4uo0e_ b.19.1.2 (E:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
sqnpisnnntatlclghhavangtlvktisddqievtnatelvqsismgkicnnsyrild
grnctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtlef
taegftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiw
gihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpg
dilminsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkv
tygkcpkyirqntlklatgmrnvpe

Timeline for d4uo0e_:

• d4uo0e_ first appeared in SCOPe 2.05
  
• d4uo0e_ appears in SCOPe 2.07
  
• d4uo0e_ appears in the current release, SCOPe 2.08