Lineage for d4uo0e_ (4uo0 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776046Species Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258558] (3 PDB entries)
  8. 2776049Domain d4uo0e_: 4uo0 E: [267442]
    Other proteins in same PDB: d4uo0b_, d4uo0d_, d4uo0f_
    automated match to d4unzc_
    complexed with bma, edo, nag

Details for d4uo0e_

PDB Entry: 4uo0 (more details), 1.9 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4uo0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo0e_ b.19.1.2 (E:) automated matches {Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
sqnpisnnntatlclghhavangtlvktisddqievtnatelvqsismgkicnnsyrild
grnctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtlef
taegftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiw
gihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpg
dilminsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkv
tygkcpkyirqntlklatgmrnvpe

SCOPe Domain Coordinates for d4uo0e_:

Click to download the PDB-style file with coordinates for d4uo0e_.
(The format of our PDB-style files is described here.)

Timeline for d4uo0e_: