Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries) |
Domain d4uo0d_: 4uo0 D: [267441] Other proteins in same PDB: d4uo0a_, d4uo0c_, d4uo0e_ automated match to d4uo1b_ complexed with bma, edo, nag |
PDB Entry: 4uo0 (more details), 1.9 Å
SCOPe Domain Sequences for d4uo0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo0d_ h.3.1.1 (D:) automated matches {Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]} gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq
Timeline for d4uo0d_: