SCOP 1.55: Domain d1ivpb_: 1ivp B:

Lineage for d1ivpb_ (1ivp B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d1ivpb_: 1ivp B: [26744]

Details for d1ivpb_

PDB Entry: 1ivp, 2.5 Å

PDB Description: the crystallographic structure of the protease from human immunodeficiency virus type 2 with two synthetic peptidic transition state analog inhibitors

SCOP Domain Sequences for d1ivpb_:

Sequence; same for both SEQRES and ATOM records:

>d1ivpb_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d1ivpb_:

• d1ivpb_ appears in SCOP 1.57
  
• d1ivpb_ appears in the current release, SCOPe 2.08