Lineage for d4uo0b_ (4uo0 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969971Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries)
  8. 1969972Domain d4uo0b_: 4uo0 B: [267439]
    Other proteins in same PDB: d4uo0a_, d4uo0c_, d4uo0e_
    automated match to d4uo1b_
    complexed with bma, edo, nag

Details for d4uo0b_

PDB Entry: 4uo0 (more details), 1.9 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4uo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo0b_ h.3.1.1 (B:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo0b_:

Click to download the PDB-style file with coordinates for d4uo0b_.
(The format of our PDB-style files is described here.)

Timeline for d4uo0b_: