![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258558] (3 PDB entries) |
![]() | Domain d4uo0a_: 4uo0 A: [267438] Other proteins in same PDB: d4uo0b_, d4uo0d_, d4uo0f_ automated match to d4unzc_ complexed with bma, edo, nag |
PDB Entry: 4uo0 (more details), 1.9 Å
SCOPe Domain Sequences for d4uo0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo0a_ b.19.1.2 (A:) automated matches {Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]} qnpisnnntatlclghhavangtlvktisddqievtnatelvqsismgkicnnsyrildg rnctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtleft aegftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiwg ihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpgd ilminsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkvt ygkcpkyirqntlklatgmrnvpek
Timeline for d4uo0a_: