SCOPe 2.05: Domain d4unyf_: 4uny F:

Lineage for d4unyf_ (4uny F:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [267994] (1 PDB entry)

8. Domain d4unyf_: 4uny F: [267437]
   Other proteins in same PDB: d4unya_, d4unyc_, d4unye_
   automated match to d4unzb_
   complexed with nag

Details for d4unyf_

PDB Entry: 4uny, 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-3sln

PDB Compounds: (F:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4unyf_:

Sequence; same for both SEQRES and ATOM records:

>d4unyf_ h.3.1.1 (F:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

Timeline for d4unyf_:

• d4unyf_ is new in SCOPe 2.05-stable
  
• d4unyf_ appears in SCOPe 2.06
  
• d4unyf_ appears in the current release, SCOPe 2.08