Lineage for d4unyf_ (4uny F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041487Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [267994] (1 PDB entry)
  8. 3041490Domain d4unyf_: 4uny F: [267437]
    Other proteins in same PDB: d4unya_, d4unyc1, d4unyc2, d4unye_
    automated match to d4unzb_
    complexed with nag

Details for d4unyf_

PDB Entry: 4uny (more details), 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-3sln
PDB Compounds: (F:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4unyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unyf_ h.3.1.1 (F:) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4unyf_:

Click to download the PDB-style file with coordinates for d4unyf_.
(The format of our PDB-style files is described here.)

Timeline for d4unyf_: