SCOPe 2.07: Domain d4unyc1: 4uny C:2-329

Lineage for d4unyc1 (4uny C:2-329)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (21 species)
   not a true protein

7. Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258560] (6 PDB entries)

8. Domain d4unyc1: 4uny C:2-329 [267434]
   Other proteins in same PDB: d4unyb_, d4unyc2, d4unyd_, d4unyf_
   automated match to d4unzc_
   complexed with nag

Details for d4unyc1

PDB Entry: 4uny, 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-3sln

PDB Compounds: (C:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unyc1:

Sequence; same for both SEQRES and ATOM records:

>d4unyc1 b.19.1.2 (C:2-329) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
qnptsgnntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldg
rnctlidamlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleft
aegftwtgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwg
ihhpssnkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgd
ilminsngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkit
ygkcpkyirqntlklatgmrnvpekqir

Timeline for d4unyc1:

• d4unyc1 first appeared in SCOPe 2.05, called d4unyc_
  
• d4unyc1 appears in SCOPe 2.06
  
• d4unyc1 appears in the current release, SCOPe 2.08