Lineage for d4unyc_ (4uny C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778498Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258569] (5 PDB entries)
  8. 1778501Domain d4unyc_: 4uny C: [267434]
    Other proteins in same PDB: d4unyb_, d4unyd_, d4unyf_
    automated match to d4unzc_
    complexed with nag

Details for d4unyc_

PDB Entry: 4uny (more details), 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-3sln
PDB Compounds: (C:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unyc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
pdqnptsgnntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvl
dgrnctlidamlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtle
ftaegftwtgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyi
wgihhpssnkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkp
gdilminsngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnk
itygkcpkyirqntlklatgmrnvpekqir

SCOPe Domain Coordinates for d4unyc_:

Click to download the PDB-style file with coordinates for d4unyc_.
(The format of our PDB-style files is described here.)

Timeline for d4unyc_: