![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258560] (6 PDB entries) |
![]() | Domain d4unyc1: 4uny C:2-329 [267434] Other proteins in same PDB: d4unyb_, d4unyc2, d4unyd_, d4unyf_ automated match to d4unzc_ complexed with nag |
PDB Entry: 4uny (more details), 2.9 Å
SCOPe Domain Sequences for d4unyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4unyc1 b.19.1.2 (C:2-329) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]} qnptsgnntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldg rnctlidamlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleft aegftwtgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwg ihhpssnkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgd ilminsngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkit ygkcpkyirqntlklatgmrnvpekqir
Timeline for d4unyc1: