SCOPe 2.08: Domain d4ua4a_: 4ua4 A:

Lineage for d4ua4a_ (4ua4 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)

8. Domain d4ua4a_: 4ua4 A: [267430]
   automated match to d4pvob_
   complexed with 3c7, gol, zn

Details for d4ua4a_

PDB Entry: 4ua4, 1.25 Å

PDB Description: Structure of the VIM-2 Metallo-beta-Lactamase in Complex with a Bisthiazolidine Inhibitor

PDB Compounds: (A:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d4ua4a_:

Sequence; same for both SEQRES and ATOM records:

>d4ua4a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkah

Timeline for d4ua4a_:

• d4ua4a_ first appeared in SCOPe 2.05
  
• d4ua4a_ appears in SCOPe 2.07