Lineage for d4u7sa_ (4u7s A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (145 PDB entries)
  8. 2347775Domain d4u7sa_: 4u7s A: [267428]
    automated match to d4kfzd_
    complexed with so4

Details for d4u7sa_

PDB Entry: 4u7s (more details), 2.07 Å

PDB Description: homodimeric single domain antibody (sdab) against staphylococcal enterotoxin b (seb) crystallized for 5 months
PDB Compounds: (A:) sdAb A3

SCOPe Domain Sequences for d4u7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u7sa_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
yafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
gqgtqvtvss

SCOPe Domain Coordinates for d4u7sa_:

Click to download the PDB-style file with coordinates for d4u7sa_.
(The format of our PDB-style files is described here.)

Timeline for d4u7sa_: