Lineage for d1ivqb_ (1ivq B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299835Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 299836Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 299837Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 300161Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)
  7. 300162Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)
  8. 300190Domain d1ivqb_: 1ivq B: [26742]
    complexed with cpv, npt, qnc; mutant

Details for d1ivqb_

PDB Entry: 1ivq (more details), 2.6 Å

PDB Description: the crystallographic structure of the protease from human immunodeficiency virus type 2 with two synthetic peptidic transition state analog inhibitors

SCOP Domain Sequences for d1ivqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivqb_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

SCOP Domain Coordinates for d1ivqb_:

Click to download the PDB-style file with coordinates for d1ivqb_.
(The format of our PDB-style files is described here.)

Timeline for d1ivqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ivqa_