Lineage for d4u0ea2 (4u0e A:148-219)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1992228Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1992302Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1992303Protein automated matches [191156] (10 species)
    not a true protein
  7. 1992345Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (3 PDB entries)
  8. 1992346Domain d4u0ea2: 4u0e A:148-219 [267417]
    Other proteins in same PDB: d4u0ea1
    automated match to d2m8pa2
    complexed with 1b0, cl

Details for d4u0ea2

PDB Entry: 4u0e (more details), 2.04 Å

PDB Description: Hexameric HIV-1 CA in complex with PF3450074
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4u0ea2:

Sequence, based on SEQRES records: (download)

>d4u0ea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d4u0ea2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqetetllvqnanpdcktilkalgpgatle
emmtacq

SCOPe Domain Coordinates for d4u0ea2:

Click to download the PDB-style file with coordinates for d4u0ea2.
(The format of our PDB-style files is described here.)

Timeline for d4u0ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u0ea1