Lineage for d4u0ea1 (4u0e A:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000672Protein HIV-1 capsid protein [47945] (1 species)
  7. 2000673Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2000721Domain d4u0ea1: 4u0e A:1-147 [267416]
    Other proteins in same PDB: d4u0ea2
    automated match to d2m8la1
    complexed with 1b0, cl

Details for d4u0ea1

PDB Entry: 4u0e (more details), 2.04 Å

PDB Description: Hexameric HIV-1 CA in complex with PF3450074
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4u0ea1:

Sequence, based on SEQRES records: (download)

>d4u0ea1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d4u0ea1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghq
aamqmlketineeaaewdrlhpvhpiapgqmreprgsdiagttstlqeqigwmthnppip
vgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d4u0ea1:

Click to download the PDB-style file with coordinates for d4u0ea1.
(The format of our PDB-style files is described here.)

Timeline for d4u0ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u0ea2