SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4tz8a1 (4tz8 A:981-1108)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (8 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (375 PDB entries)
  8. 1992800Domain d4tz8a1: 4tz8 A:981-1108 [267415]
    Other proteins in same PDB: d4tz8a2
    automated match to d4tz2a_
    complexed with 39u, cl, so4

Details for d4tz8a1

PDB Entry: 4tz8 (more details), 2.15 Å

PDB Description: Structure of human ATAD2 bromodomain bound to fragment inhibitor
PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d4tz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tz8a1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

SCOPe Domain Coordinates for d4tz8a1:

Click to download the PDB-style file with coordinates for d4tz8a1.
(The format of our PDB-style files is described here.)

Timeline for d4tz8a1:

  • d4tz8a1 first appeared in SCOPe 2.05, called d4tz8a_

View in 3D
Domains from same chain:
(mouse over for more information)
d4tz8a2