Lineage for d4tz8a1 (4tz8 A:981-1108)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (7 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (372 PDB entries)
  8. 1992800Domain d4tz8a1: 4tz8 A:981-1108 [267415]
    Other proteins in same PDB: d4tz8a2
    automated match to d4tz2a_
    complexed with 39u, cl, so4

Details for d4tz8a1

PDB Entry: 4tz8 (more details), 2.15 Å

PDB Description: Structure of human ATAD2 bromodomain bound to fragment inhibitor
PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d4tz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tz8a1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

SCOPe Domain Coordinates for d4tz8a1:

Click to download the PDB-style file with coordinates for d4tz8a1.
(The format of our PDB-style files is described here.)

Timeline for d4tz8a1:

  • d4tz8a1 first appeared in SCOPe 2.05, called d4tz8a_

View in 3D
Domains from same chain:
(mouse over for more information)
d4tz8a2