Lineage for d4tqbb_ (4tqb B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962643Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2962644Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2962648Species Human (Homo sapiens) [TaxId:9606] [160542] (16 PDB entries)
  8. 2962650Domain d4tqbb_: 4tqb B: [267412]
    automated match to d1ipca_
    complexed with 34k, mes, mgt

Details for d4tqbb_

PDB Entry: 4tqb (more details), 1.59 Å

PDB Description: The co-complex structure of the translation initiation factor eIF4E with the inhibitor 4EGI-1 reveals an allosteric mechanism for dissociating eIF4G
PDB Compounds: (B:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4tqbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqbb_ d.86.1.1 (B:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf
kdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavv
nvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgsttknr
fvv

SCOPe Domain Coordinates for d4tqbb_:

Click to download the PDB-style file with coordinates for d4tqbb_.
(The format of our PDB-style files is described here.)

Timeline for d4tqbb_: